The post argues that cultural progress hinges on embracing narrated books from leading intellectuals; by learning through these worksârepeatedly and reflectivelyâpeople can absorb the best ideas while shedding outdated ones. It stresses that education, not mere tradition, drives growth, and that a personal library of powerful narratives equips individuals to resist deception and manipulation. In essence, continuous study of transformative books enriches culture, unites it with global wisdom, and safeguards it against exploitation.
#0923 published 04:13 audio duration372 wordsculturebooksnarrationpersonal-libraryeducationmodernisationknowledge
The post argues that many of societyâs systemsâgrades, borders, wars, prisons, schoolsâare mere games or rituals that mask underlying problems such as poverty and miscommunication. It suggests simple fixes like universal basic income and better education but claims we still pretend the current systems are working. To break out of these âgames,â it encourages personal initiative: start learning programming, digital arts, and entrepreneurship from highâschool years, build small startups until you find one that works, then grow your skills and knowledge. The author sees this as a quest for authenticity, urging readers to write books, keep learning, and dedicate themselves to selfâeducation so they can âgrow all the way upâ and become great beings.
#0922 published 05:03 audio duration414 words3 linkseducationstartupsprogrammingdigital-music-composition3d-modelingdigital-painting
The post explains the âfenceâpostâ problem that arises in programming when counting elements of a list (or array) and using zeroâbased indices. By walking through an example with three apples, it shows how to set up a forâloop: initialize the counter at 0, use the condition âcounterâŻ<âŻarray.lengthâ, and increment the counter each iteration; this yields counters 0,âŻ1,âŻ2 and stops before reaching 3, which is the correct loop boundary. The author also discusses common mistakes such as using ââ¤â instead of â<â or starting at 1, and notes that while some libraries choose to expose a oneâbased page number for convenience, the underlying code should still be zeroâbased for consistency. In short, the article illustrates why programmers must remember that array indices begin at 0 and loop conditions should reflect that fact.
#0921 published 06:58 audio duration594 words1 linkfence post problemzero based indexingarray loopsjavascriptfor loop
The author argues that the traditional school system relies on rigid preârequisite classes, timed lectures, and rote memorization designed for state tests rather than genuine learning, so teachers can easily earn salaries by moving students through a fixed sequence of facts. He claims real education should be driven by student curiosity, project work, and flexible, handsâon experiencesâlike building 3D printers or creating musicâthat let learners discover concepts naturally. The post calls for abandoning strict subject divisions and allowing students to pursue interests at their own pace, suggesting that true learning happens when teachers act as facilitators rather than schedulers of memorization.
#0920 published 15:10 audio duration1,189 words3 linkseducationschoolsteachersclassroomsprerequisitesprojectsself-learning3dprintingraspberrypiprogrammingartclassesmusiccomposition
The author reflects on human nature as an inherent drive toward growth, safety, and selfâeducation, arguing that wars, poverty, and weak schooling systems have thwarted the cultivation of true talent. He critiques conventional education for delivering only ânoiseâ and superficial knowledge, claiming teachers often fail to turn lessons into real skills; a programming class should produce a working coder, an art lesson should yield genuine painting ability, and a 3âD modeling course should culminate in a tangible creation. The post stresses that the responsibility of learning lies with each individual: by actively pursuing curiosity, turning it into talent, and taking ownership of oneâs own education, we can become âgreat beingsâ and help rebuild a culture where nurture, wisdom, and lifelong learning replace institutional paychecks.
#0919 published 07:18 audio duration651 wordshuman naturenurtureeducationself-educationculturewarpoverty
The post argues that learning any new skillâwhether a language, programming, or artâis driven by practical context rather than textbook theory; just taking classes produces rote memorization and âgibberishâ work, while actually writing programs (or building static site generators) forces deeper understanding and quick mastery. It illustrates this with examples from 3âD modeling, where having a printer as a concrete tool anchors learning, and digital painting, where using reference images streamlines composition and color work. The author concludes that schools often deliver only shallow context, stifling creativity, and calls for real-world learning environments that yield lasting results.
#0918 published 06:26 audio duration535 words1 linklanguage-learningprogrammingstatic-site-generator3d-modelingdigital-painting
The narrator begins by recalling how âMotherâŻNatureâ invited him into her woodland world, only to return home after days of solitude, reading books and reflecting on his own appearance; he then recounts vivid memories of watching the Hel Peninsula from the Baltic Sea, strolling along the Great Lakes and Nordhouse Dunes, and enjoying nights with seagull companionsâhis âsea catsâ that made the moonlit evenings feel blessedâand concludes that this journey through nature has brought him wisdom, a sense of belonging, and a feeling of graduation as he re-enters civilization.
#0917 published 03:55 audio duration411 wordspoetrynaturevacationsealakes
I started my coding journey with simple visual tools that felt like a boardâgame, then moved through a stack of languagesâVisualâŻBasic, ASP, Perl, PHP and finally JavaScriptâlearning each from scratch projects such as a âFormMailâ clone and later building dragâandâdrop workflows reminiscent of Blenderâs Geometry Nodes. Along the way I discovered how powerful Gulpâs `parallel()` and `series()` functions are for automating tasks (e.g., resizing images in parallel, compressing and publishing sequentially), and I even practiced with the WarriorJs game where you program a characterâs moves via simple method calls. All of this shows that programming can be both playful and practical, turning any task into an automated, often overâengineered masterpiece.
#0916 published 08:21 audio duration716 words6 linksprogrammingjavascriptweb-developmentgulpparallel-processingseries-functions
The post argues that learning is most effective when tailored to an individualâs own pace and interests; formal schooling often fails because it imposes fixed sequences and generic knowledge. To succeed in interviews and real work, one must build functional, exceptional knowledgeâespecially in software developmentâby creating personal projects such as inâmemory databases with distributed hash tables, documenting them, writing tutorials, and sharing plugins online. Starting early, a learner should map their curiosities into a mindâmap, iteratively exploring new topics and building side projects that evolve into businesses; this cycle of selfâeducation yields true expertise beyond rote diplomas.
Each child is a unique creation, and humanity must craft a culture that inspires, nurtures, and educatesâan architecture of art where wisdom, not manipulation, guides life. The post argues that wars, borders, and cults are arbitrary tricks that waste time and cause poverty; the remedy lies in simple yet profound ideas: clear, dignified schooling that builds abilities for future generations to fix climate and end war, while abandoning bad ideas, hate, and endless taking.
#0914 published 04:26 audio duration387 wordscultureeducationchildrengenerationsclimatewarpoverty
The poem celebrates humanityâs inherent beauty and freedom, arguing that broken cultures lose their nurturing power while compromises erode wisdom. It calls for unity, growth, and education that enlightens the young without stagnation; poverty is seen as a source of terror and war merely a temporary ceasefire. Schools should be free from cruelty, and the world belongs to future generationsâso we must become farâseeing wise beings.
#0913 published 02:19 audio duration174 wordspoetrycultureunityhumanity
The post explains that curiosity is simply noticing something newâlike learning to use a 3âD printerâwhile an idea is what emerges from that curiosity and can be developed into something useful or creative; the author illustrates this with examples such as building a multiâlayer 3âD printed wallet, telling a âyoâŻmamaâ joke he claims to have invented, and finally describing his new Lowbrowâart technique of using kitten head proportions to guide adult portrait drawings. He stresses that ideas are worth recording, nurturing, and never underestimating, because they can bring joy, laughter, and personal fulfillment when turned into tangible projects or artworks.
#0912 published 15:45 audio duration1,257 words1 linkideacuriosity3d printingwallet designlowbrow artportraitpainting
A young woman from an ancient city, inspired by a beautiful kitten, sought to master art and journeyed to a renowned artistic village where she consulted its wisest man. He instructed her to meditate, but after each meditation the woman returned with newly invented toolsâsightâsize, proportional divider, grid method, graphite paper, viewing frame, light box, camera obscuraâthat gradually shaped modern drawing techniques; yet each invention prompted the wise man to send her back, insisting on simplicity. After many experiments and days of practice, she finally understood that only a simple thumb measurement was needed, defeated the wise man in front of the village, and thus proved her mastery. The tale concludes with the moral that those who impede artâwhether by belittling, profiting, or claiming wisdomâwill be remembered as fools.
#0911 published 04:31 audio duration306 words11 linksstorymythartinventiondrawing toolscamera obscuralightboxgridmethodgraphitepaperviewingframekrita
The post explains that starting an art practice by using reference images directlyâoften called âtracingââlets you learn quickly and build a personal style through shortcuts and visual pleasure. It recommends beginning with affordable tools like a $50 pen, tablet, and free software such as Krita to access its referenceâimage tool and create your own compositions. Once you master laying out scenes from references, you can shift to freehand drawing while still grounding yourself in realistic physics, but also bending reality to invent colors and light. The author illustrates this with an example of painting a politicianâs face: study the eyes and laughter from references, then compose the final piece freehand, ensuring harmony and purpose behind each sketch.
#0910 published 06:36 audio duration527 words2 linksreference-imageskritafreehandhyperrealistic
The author reflects on reshaping our world by uniting cultures through education, arguing that only by ending global povertyâvia universal income banks and free schoolingâcan people rise from low levels of learning. He stresses the need for a topâdown design that brings all cultures together, uses art to show students what a classroom should be, and believes this educational revolution will lift minds and dissolve borders.
#0909 published 03:12 audio duration273 words2 linkspoetryeducationglobalpovertyuniversalbasicincomeartculture
By applying a reference image directly onto the canvas, an artist can create a faithful hyperârealistic reproduction that serves both as a master study of the subject and proof of their skill. Once this stage is mastered, the artist gains a solid launchpad from which to explore eye, lip, nose, cheek, and hand details through targeted tutorials; these lessons refine positioning and deepen artistic control. As the process continues, the artist learns to simplify shadows and stylize features, transforming detailed studies into memorized faces that can be reproduced spontaneously. This progressionâfrom precise hyperârealism through simplification to fullâbody posesâbuilds a memory bank of facial features and postures, enabling the sketching of complete scenes and ultimately producing uniquely personal works.
#0908 published 04:12 audio duration318 wordshyper-realistreference-imageeye-drawingpaintingart-techniquestylizationfull-body-painting
The post explains that art is an innate skill that needs structured practiceâmuch like learning to write or ride a bikeâand that tools such as ruled paper, grids, and proportional dividers help beginners stay on track; it also encourages using free openâsource programs (e.g., Krita) for color picking and image references so you can learn to mix colors effectively; the writer suggests inexpensive yet effective suppliesâpencils, canvas or graphite paper, a small projector for tracing images, and eventually a pen tabletâto build confidence before moving into more advanced techniques like 3âD shading; ultimately, mastering these basics will let you create art that transforms lives and invites others to join your creative journey.
#0907 published 09:39 audio duration916 words6 linksartdrawingpencilsgridstracing-papercolor-pickingkritaprojectortutorials
The post argues that many âmentorâ artists underestimate newcomers, guiding them on a long journey rather than letting them become equally skilled, and that true art must be free of manipulation, selfâdelusion, and lies. The author declares everyone a natural artist and invites those who use art merely to showcase themselves to switch to magic, whose code is clear and unviolated. Digital art, the writer says, should not simply copy life but elevate it by using its full range of toolsâ3âD modeling, perspective, shadowsâand techniques such as photoâbashing, colorâpicking, and tracing; freehand sketches are just one style. Finally, the post stresses that handâeye coordination develops naturally when aided by gadgets, that young people already possess the intelligence to learn art, and that artists should not take the medium away from them.
The author explains why choosing the right reference photo is key for any portrait: a model must pick an image that truly shows her face under good lighting, from the proper angles, and in a way she feels it represents her. He argues that even with 3âD rigs or many photos, the final choice still needs the modelâs approval, otherwise the finished painting will feel wrong to the subject. The post contrasts simple photo selection with more complex photogrammetry, notes how stylized changes can be added after a solid base, and stresses that an artistâs responsibility is to capture the modelâs real appearance before adding any idealisations. Links to a titleâimage contest and a timeâlapse video are included as examples.
#0905 published 06:49 audio duration538 words2 linksportraitphotogrammetry3d-modelingphoto-selectionpainting
The post is a streamâofâconsciousness meditation on the human condition, arguing that true learning comes from stepping outside of pain and recognizing how our own missteps become the root of suffering. The author uses art as an illustration: good work fails if it only paints misery, just as war propaganda masks truth. He tells us to âcrawl through a tunnel of shitâ â i
#0904 published 18:11 audio duration1,383 wordspoetryfreeformessayselfhelpartmusicfilmnarrative
The author explains that creating art is not magic but a systematic process of navigation through techniquesâusing reference images, tracing paper, grid methods or digital toolsâto learn composition, color sampling, and mixing; practice turns these steps into habits, just as learning to navigate a city. He sees the first âlobbyâ of art as a place where beginners become perfect artists by mastering fundamentals, then expanding beyond them, and he frames art as a test of worthiness that rewards teachers who bring others into this starting circle so they too can grow. Ultimately, good art is defined not by subjective feeling but by its power to change lives, and new schools of art will emerge to free humanity from poverty and darkness.
#0903 published 09:22 audio duration839 words7 linksartdigital-artreference-imagestracing-papergrid-methodcolor-pickingartist-development
The post argues that a painting should âspeakâânot with misery, but with meaningâand that its message can be either inspirational or humorous. It suggests blending images with text, stories etched on stone walls, stillâlife scenes of books and objects, or punchlines framed by a funny setup (like a cat in a suit) to bring both mood and laughter into the viewerâs day. By using familiar quotes or personal joy as sources of inspiration, an artist can create works that lift spirits and help people balance their lives, even though not everyone will laugh or be inspired. The author ends with links to a âTitle Imageâ contest and timeâlapse video for further reference.
#0902 published 04:52 audio duration316 words2 linkspoetrypaintingartinspiration
The post outlines three main approaches to artâQuasimodo, Digital Art, and Lowbrowâeach with its own flavor. Quasimodo represents traditional classroom learning that can feel formulaic, yet some teachers are revisiting it to make it more innovative. The Digital Art method highlights how modern tools empower artists by bringing Renaissance techniques into contemporary practice, with light projection seen as a fundamental teaching aid. Finally, Lowbrow art embraces preset proportions and simple equipment to create charming, accessible works that resonate with viewers; the author shares a personal anecdote illustrating how this style can delight both artist and audience alike.
#0901 published 06:00 audio duration392 wordsartdigital artlowbrowpaintingtoolseducation
This post explains a simple, repeatâbased method for drawing faces quickly and accurately. It suggests using tracing paper, a projector or transparent digital layers to get proportions right at first glance, then skipping an initial sketch and painting shadows immediately. By repeatedly copying portraits with similar lighting, the artist learns to map key featuresâeyes, nose, mouthâinto their correct positions before adding details, so that later compositions feel natural and consistent. In short, memorizing a face through repetition builds a mental âmapâ of light, shadow and feature placement, enabling an artist to produce at least one finished portrait per day with minimal extra steps.
#0900 published 04:55 audio duration413 wordspaintingportraitfacetechniquepracticerepetitiondigital arttracing paperprojectorairbrushproportionslayers
