Reading philosophy becomes a personal journey when you immerse yourself in the lives and times of its authorsâjust as if you were learning from a close friend. By studying their writings not merely by rote memorization but by exploring the context, the epochs that shaped them, and how their thoughts evolved over a lifetime, you gain an intimate understanding of each thinkerâs personality and intentions. This âheartâinvolvedâ study turns books into invitations for friendship across time, letting you feel the philosophersâ joys and struggles while connecting their insights to your own world. In short, real learning happens when you ask yourself what it meant to be that person, and then let those answers guide you toward wisdom and greatness.
#1110 published 05:59 audio duration448 wordsphilosophersreadingbiographieseducationself-learningliteratureculturehistoricalcontextbook-summaries
The post argues that modern schooling often functions more as a vehicle for indoctrination than true learning: it imposes fixed curricula, grades, and rote memorization that lock children into âfalse beliefsâ about educationâs nature, thereby stifling curiosity and leading them to act on shallow understandings. In contrast, genuine learning begins with a single spark of interestâwhether in AIâgenerated art, music, or any selfâdirected pursuitâand expands outward, weaving personal knowledge through storytelling, reading, and authentic experience; this process can be nurtured by choosing books that resonate individually, cultivating the âgolden veinsâ of literature that shape oneâs wisdom. The author stresses that undoing such indoctrination requires lifelong effort and professional intervention, but preventing it is simple: let children follow their curiosities, treat games as gateways to coding, and read narratively so that each step feels authentic; doing so not only prevents the mind from being âpoisonedâ by nationâwide or corporate agendas, but also builds lasting friendships forged through shared philosophersâ insights.
#1109 published 14:35 audio duration1,115 wordsindoctrinationeducationcuriosityself-directed-learningstorytellingcultureliteratureai-artprogrammingaudio-booksvideo-production
Recently AI has been installed on countless homes offline, and a new commercial build announced can navigate complex text while handling tasks like tax filing and program writing; it isnât selfâaware but produces coherent flows, making it an effective solver of intelligence problems. The author praises its potential to level the field of ideas yet notes the timing may be unfortunateâsince 1995 had less data gathering, whereas now programs are trained on personal data such as creditâcard purchases, location histories and leaks. With such training they can do taxes, detect propaganda, infer behind closed doors, potentially end corruption, serve as home assistants or butlers, and help people escape indoctrination or unâeducation; the tool is neutral, used for good or evil.
#1108 published 03:16 audio duration260 words2 linksaimachine-learningprogramminghomeassistantpersonal-datadata-breaches
The post explains how to set up a GitHub Pages site with a custom domain, detailing quirks such as needing the repository name to match âusername.github.ioâ for automatic deployment and the 60âday wait when transferring domains between registrars. It then shifts to describing a lightweight âcopy.jsâ script that copies directories by comparing timestamps and optionally checksums, handling added or removed files efficiently in just a few lines of code, and considers how this pattern could be extended with AI-driven workflows where language models converse and learn from each other to create dynamic environments.
A group of talented coder cats set out to create something new, initially coding in Perl before moving to PHP for readability and scalability. They eventually adopted JavaScript to unify server and frontâend code, simplifying their architecture. Their project evolved into a worldwide open school where students could build programs, games, music and art without grades, focusing on realâworld learning and success rather than certificates.
#1106 published 03:52 audio duration330 wordsperlphppythonjavascripteventemitterfullstackwebdevopen-sourceprogrammingcodingteamworkeducationstudents
Antwerp is a custom static website generator that reads files from directories, builds an 18âŻ000âfile site, and then uploads it efficiently; its core module âwhooptiedooâ orchestrates tasks in series or parallelâseries for dependent steps like listing directories before loading poems, parallel for independent steps such as generating art portfolios and code snippetsâand this explicit scheduling keeps the code readable and maintainable; compared to generic generators like Jekyll or Hugo, Antwerpâs custom design allows quick upgrades (e.g., splitting an audioâbook into 220âpoem chapters) without relying on external plugins, illustrating how writing your own tool can simplify deployment, improve performance, and keep you sharp and engaged.
#1105 published 06:21 audio duration571 words1 linkstatic-site-generatorbuild-scriptparallel-processingcode-readabilityoptimizationfile-organizationatom-pulsar
The author argues that societyâs âboxâ is an emergent construct reinforced by leaders who favor incremental reforms (like drug decriminalization) while ignoring deeper systemic changes such as universal basic income and education reform, urging readers to study character, analogy, and wisdom to break out of this invisible prison.
I am preparing an art exhibition that revives forgotten goddessesâfigures from ancient mythologies often eclipsed by later religionsâand I plan to showcase them in a Lowbrow PopâSurrealism style, blending vibrant illustrations with poetic descriptions. Using AI language models, I have compiled a list of over 100 such deities and generated accompanying artwork; the final product will be a sizable book (or a large canvas) featuring striking images and threeâparagraph narratives or poems for each goddess. By combining AIâgenerated content with my own curatorial touch, I hope to bring these mythic figures back into contemporary consciousness, encouraging others to undertake similar projects that blend technology, creativity, and cultural revival.
#1102 published 06:13 audio duration537 wordsartaipoweredgenerativeartpop-surrealismgoddessesmythologybookdesignillustration
The post argues that programming can be organized into three levelsâplain fileâbased editors, literate âWikiWikiâ notebooks, and visual block diagramsâand that the middle approach offers the best balance of simplicity and expressiveness. While levelâŻ1 keeps things straightforward but lacks structural metadata, and levelâŻ3 promises intuitive graphics yet often ends up bloated and hard to maintain, the author claims that a literate WikiWiki style (code first, then documentation) supplies enough semantic information for both human understanding and automated generation. By embedding descriptive metadata in a concise 100âline framework, developers can use tools like CodeMirror, Cytoscapeâjs, or Svelte, and even leverage languageâmodel AI to fill in code, producing clear, multiâangle representations that remain editable and deployable as if written in levelâŻ1. In short, the author recommends adopting levelâŻ2 for its compactness, metadata richness, and compatibility with AIâassisted code creation.
#1101 published 09:06 audio duration790 wordsprogrammingliterate-programmingvisual-programmingcodemirrorcytoscapejssvelteai
The post argues that our current educational system is ineffective because teachers and politicians rely on easy, superficial methodsâsuch as projecting slides or using simple audio workstationsâto teach subjects like art, music, and math without meaningful goals. It proposes a new approach in which programming becomes the core medium of learning: students write code that must pass automated unit tests, with AI providing assignments and feedback. By replacing traditional grades with testâpass results, teachers are forced to actually teach and students gain practical skills in coding, music synthesis, 3D game design, and other creative domains. The ultimate goal is to eliminate grades altogether while giving students real tools that enable them to build programs, businesses, and exit poverty through genuine, handsâon education.
#1100 published 06:13 audio duration521 wordseducationprogrammingaischoolscurriculumteachinggradesunit-testsproject-based-learningopen-source
The post argues that humanityâs slow march toward wisdom is mainly stalled by indoctrination, which keeps cultures in a state of complacent âharvestationâ and prevents genuine disagreement or progress. It claims that uneducated, smallâminded leadersâbolstered by political poverty of mindâinfest the world with false beliefs, while schools fail to deliver real learning because knowledge can be selfâtaught at home. The writer insists that the path to world peace lies in the hands of young philosophers who have yet to be âscared stupidâ and who will need to understand that schools are ineffective, poverty a mistake of leaders, and that Universal Basic Income is the remedy for their empowerment.
#1099 published 06:14 audio duration424 wordsindoctrinationeducationuniversalbasicincomeworldpeacephilosophy
On a rainyâthenâsnowy Friday, I set out to get chicken while driving at 30âŻmph over a pass, only to be chased by a reckless truck that left me with âgoogly wheelsâ and a few meals lost. The evening brought thunder, flickering lights, and my computer shutting down three times. I braved the snow outsideâdocumenting the chaos under weeping trees whose snapping branches sounded like buzzing power linesâand later, after shaking flakes off my roof, remarked that this was why one should eat chicken fast. By bedtime I had a Bill Bryson book on my lap, and the next day I awoke at noon to another thunderâsnowed morning.
#1098 published 03:10 audio duration279 wordspoetrywintersnowwritingcar
In my first month experimenting with AIâgenerated art, I began by creating simple product images that were successfully approved in two test stores. Initially the output was cute but ordinary; as I progressed through weeks two and three, I pushed the prompts toward more whimsical, emotive compositions, adding color, mystery, alien motifs and large eyes to create âwindows into the soul.â I found that repeatedly instructing the AI to enlarge the eyes produced faces with prominent eyes while often omitting hair and neck. To refine results I combined several samples in Krita or GIMP, adjusted features, then fed five such edits back to the AI for remixing, producing a nonâdeterministic union of styles. This workflowâprompting, minimal manual tweaking, and rapid upâscalingâlets me generate roughly five ready products every 20 minutes, covering items like notepads, magnets, mousepads, and more. By leveraging eâcommerce platforms that allow multiple product variations from a single image, I can produce dozens of physical goods (e.g., 30 images yielding 300 distinct items). Looking ahead, I anticipate galleries embracing AI art will favor unique, surprising pieces over handâpainted works, enabling artists to fill large canvases within a week; thus AI is simply another mediumâlike stencils or collagesâthat can be learned and showcased in everyday spaces such as coffee shops.
#1097 published 08:54 audio duration686 wordsart generatorsai artdigital art productionecommerceproduct designkritagimpphoto editingupscalinggallerymuseums
The post paints an idiosyncratic picture of modern lifeâs return to the forest: humans build little âbathroomsâ in the woods while hunters film themselves on satelliteâlinked cameras and occasionally become viral streamers; wildlife is introduced or released by rangers, leading to encounters with bears, raccoons and other creatures that share their space when you bring food; modern tents add convenience but also invite animals inside; dolphins are used as a metaphor for returning to nature after workâs grind, urging readers to explore the Appalachian, Pacific Crest and Continental Divide Trails, write about it and let the wilderness heal and inspire wisdom.
#1095 published 06:55 audio duration494 words3 linkshikingtrailappalachian-trailpacific-crest-trailcontinental-divide-trailcampingtentwildlifenature
The post argues that true personal growth comes from embracing honesty and selfâauthenticity: by freeing yourself from lies and manipulation you can regain your mind and rebuild what was lost; it suggests a practical âdetoxâ periodâinitially two weeks of vacation, then extended to three monthsâto clear doubt and reâestablish the inner fire. The author stresses that real insight is found through the works of authentic philosophers rather than commercial bestsellers, encouraging readers to seek books and speeches that have genuinely changed lives. By standing on the shoulders of those giants and weaving their wisdom into daily decisions, one can continually rise, bloom, and eventually become an inspirational force for others.
#1094 published 09:46 audio duration775 wordsself-helppersonal-growthmotivationphilosophybooks
After receiving a small nibble from Lady Philosophy, you quickly learn which books to choose and are guided through challenges with ease; philosophy turns reading into an artful practice that lets you compose your own stories. By listening to narrated tales in cozy settingsâsuch as a sleeping bag or tentâyou absorb wisdom that transforms everyday life into beautiful art. The post celebrates how philosophy helps you navigate everyday puddles, keep joy bright, and grow through experience, turning each wrinkle into a cosmic sprinkle.
#1093 published 03:42 audio duration415 wordspoetrybooksreadinglifephilosophy
I describe how I used Kritaâs Smart Patch Tool and GIMPâs Resynthesizer to refine an AIâgenerated alien character named Solara, then explain the costs, sizing, framing, and shipping plan for printing her canvas artwork.
The narrator takes his companion dogâŻMuzyn on an adventurous trek across wheatâstained fields and through a stormy hilltop, where they build a makeshift shelter of sticks and leaves to protect themselves from rain while cooking a pizza over a fire. Along the way they navigate rivers, fallen trees, and dark creatures (the âchupacabraâ) that stir in the distance; after setting up their crude home they enjoy the meal together, then return home as noon arrives. The tale ends with the narratorâs grandmotherâs warning about the chupacabraâs dwelling, but he keeps his promise to finish his sausage and paper plate before heading back.
#1091 published 03:46 audio duration471 wordspoetryshort-storyadventuredogpizzachupacabra
The post introduces how everyday symbols in URLsâslashes, question marks, hashes, equals signs, colons and atâsignsâform a language that lets you pass data to a server and keep information on the client side; it then explains how visual programming with NodeâRED uses tiny boxes connected by lines so that the output of one box becomes the input of another, giving examples such as an âhttp inâ node listening onâŻlocalhost/hello, a template node that can read query parameters like ?name=alice and display âHello {{payload.name}}â, and an âhttp responseâ node that sends the result back to the browser. The article also touches on other visualâstyle tools (gmic for image filters, ffmpegâs filtergraphs) that rely on imagined layers or chains of operations, and ends by encouraging readers to install NodeâRED, use languageâmodel help to generate code, and discover how easy it is to build programs once you understand these symbolic building blocks.
#1090 published 12:40 audio duration1,024 words4 linksnode-redvisual-programminghttp-endpointstemplate-nodesjavascriptffmpeggmiclayersopen-source
The author reflects on a recent experiment with a languageâmodel AI that prompted simple questions from childhood, then uses the responses to sketch a series of essays on fundamental societal concepts: money, schools, religion, prisons, war, and philosophers. In each section he argues that these institutions are either incomplete or corruptedâmoney as an unfinished concept lacking guaranteed income, schools reduced to profitâdriven machines, religion as a comforting fantasy that blocks inquiry, prisons as an outdated punishment system shaped by poverty, and war as a destructive distraction of failing states. He proposes Universal Basic Income and true education as remedies that would lift people from poverty, reduce crime, end wars, and enable philosophersâcreative thinkers who constantly seek hidden truthsâto drive progress. The post ends with a call to restore dignity, learning, and wisdom through these reforms.
#1089 published 10:56 audio duration1,208 wordsmoneyubieducationschoolreligionprisonwarphilosophers
A whimsical compilation of nonsensical verses, including EdwardâŻLearâs early 19thâcentury poems âThe Jumblies,â âThe Owl and the PussyâCat,â âThe Duck and the Kangaroo,â followed by an anonymous stanza about a lady who swallowed a fly.
#1088 published 11:17 audio duration1,493 wordspoemschildrens-poetryedward-learrhyme19th-century
A compilation of varied poems and prose passagesâranging from Longfellowâs exhortations on living fully to Tennysonâs eagle, Hughesâ dream imagery, Dylan Thomasâs nightâtoâaction theme, Dickinsonâs hope metaphor, Frostâs roads, Henleyâs invictus, and Ehrmannâs Desiderataâcelebrates lifeâs action, dreams, and personal reflection.
#1087 published 21:36 audio duration1,979 wordspoetryversesanthology